DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and CLIC6

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:XP_016883895.1 Gene:CLIC6 / 54102 HGNCID:2065 Length:735 Species:Homo sapiens


Alignment Length:208 Identity:43/208 - (20%)
Similarity:69/208 - (33%) Gaps:70/208 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ALGLELDLRLVNVKAG---------------------------------EHKSAEFLKLNAQHTI 56
            |||.|.|:.|. ||||                                 :.|.|:...|......
Human   446 ALGQEHDITLF-VKAGYDGESIGNCPFSQRLFMILWLKGVIFNVTTVDLKRKPADLQNLAPGTNP 509

  Fly    57 PVLDDNGTIVSDSHIICSYLADKYAPEGDDSLYPKDPE----------------KRRLVDARLYY 105
            |.:..:|.:.:|.:.|..:|.:|.||.....|..:.||                |....||...:
Human   510 PFMTFDGEVKTDVNKIEEFLEEKLAPPRYPKLGTQHPESNSAGNDVFAKFSAFIKNTKKDANEIH 574

  Fly   106 DCGHLFPRIR----FIVEPVIYFGAGEVPSDRVAYLQKAYDGLEHCLAEG-DYLVGDKLTIADLS 165
            : .:|...:|    ::..|        :|.:..||      ..|.....| .:|.||:||:||.:
Human   575 E-KNLLKALRKLDNYLNSP--------LPDEIDAY------STEDVTVSGRKFLDGDELTLADCN 624

  Fly   166 CIASVSTAEAFAP 178
            .:..:...:...|
Human   625 LLPKLHIIKVHLP 637

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 43/208 (21%)
GST_N_Delta_Epsilon 5..78 CDD:239343 18/85 (21%)
GST_C_Delta_Epsilon 94..211 CDD:198287 20/106 (19%)
CLIC6XP_016883895.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154385
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.