DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and gstt1-like.2

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:XP_031748213.1 Gene:gstt1-like.2 / 496693 XenbaseID:XB-GENE-980731 Length:245 Species:Xenopus tropicalis


Alignment Length:204 Identity:58/204 - (28%)
Similarity:98/204 - (48%) Gaps:15/204 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SAKPILYYAPRSPPCRAVLLTAAALGLELD-LRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTI 65
            |::..||....|.|||:|.:.|.|..:..: .:|..:|||||.:.||.|::..|.:|.|.|....
 Frog     3 SSELTLYLDLLSQPCRSVYIFAKANRIPFNYCKLQLLKAGEHLTQEFGKVSVLHKVPALKDGNFT 67

  Fly    66 VSDSHIICSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLFPRIRFI-----VEPVIYFG 125
            :::|..:..|||.||  :..:..||.|.:||..||..|.:...:..|....:     |.|.|.  
 Frog    68 MAESTAMLLYLARKY--KTPNHWYPSDLQKRARVDEYLAWQHTNTRPHGSKVFWTKCVSPTIL-- 128

  Fly   126 AGEVPSDRV-----AYLQKAYDGLEHCLAEGDYLVGDKLTIADLSCIASVSTAEAFAPIEPDQFP 185
            ..||||:::     .::....:..|..|....::.||::::|||..|..:....|......::.|
 Frog   129 GKEVPSEKMNAVMAEFVTTMNNFEEKFLGNKPFIAGDEISVADLVAIVEIMQVIASGVNVFEERP 193

  Fly   186 RLVQWVKRI 194
            :|..|.:|:
 Frog   194 KLGSWKQRL 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 57/201 (28%)
GST_N_Delta_Epsilon 5..78 CDD:239343 25/73 (34%)
GST_C_Delta_Epsilon 94..211 CDD:198287 26/111 (23%)
gstt1-like.2XP_031748213.1 GST_N_Theta 6..82 CDD:239348 26/75 (35%)
GST_C_Theta 95..221 CDD:198292 26/110 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.