DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and gsto2

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001007373.1 Gene:gsto2 / 492500 ZFINID:ZDB-GENE-041114-67 Length:240 Species:Danio rerio


Alignment Length:211 Identity:52/211 - (24%)
Similarity:79/211 - (37%) Gaps:56/211 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LYYAPRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLD-DNGTIVSDSH 70
            ||.....|..:...|...|.|::.|:..:|:.:   |...|||.|...|:|||: .:|.::.:|.
Zfish    25 LYSMRFCPFAQRTRLVLTAKGVKHDIININLVS---KPDWFLKKNPFGTVPVLETSSGQVIYESP 86

  Fly    71 IICSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLFPRIRFIVEPVIYF-------GAGE 128
            |.|.||.:.| ||  ..|.|.||.:|......|     .|:.::      :.||       ..||
Zfish    87 ITCEYLDEVY-PE--KKLLPSDPFERAQQKMLL-----ELYSKV------IPYFYKISMGKKRGE 137

  Fly   129 VPSDRVAYLQKAYDGLEHCLA--EGDYLVGDKLTIADL---------------SCIASVSTAEAF 176
            ..|...|...:....|...||  :..|..||.:|:.|.               .|:|..      
Zfish   138 DVSTAEAEFTEKLLQLNEALANKKTKYFGGDSITMIDYLIWPWFERAEMMGVKHCLAKT------ 196

  Fly   177 APIEPDQFPRLVQWVK 192
                    |.|.:|::
Zfish   197 --------PELRKWIE 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 52/211 (25%)
GST_N_Delta_Epsilon 5..78 CDD:239343 23/71 (32%)
GST_C_Delta_Epsilon 94..211 CDD:198287 22/123 (18%)
gsto2NP_001007373.1 GST_N_Omega 4..93 CDD:239353 22/70 (31%)
GstA 25..210 CDD:223698 52/211 (25%)
GST_C_Omega 107..229 CDD:198293 22/123 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589503
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.