DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and GstD2

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster


Alignment Length:202 Identity:75/202 - (37%)
Similarity:114/202 - (56%) Gaps:6/202 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YYAPRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSDSHII 72
            ||.|....||.|::.|.||||||:.:|:|...||....||:|||.|||||.|.|||..:.:|..|
  Fly     4 YYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWESRAI 68

  Fly    73 CSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLFPRIRFIVEPVIYFGAGEVPSDR-VAY 136
            ..||.:||..  ||.|.|.||:||.:::.|||:|.|.|:........|:  |..|:..||. :..
  Fly    69 AVYLVEKYGK--DDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYYYPL--FRTGKPGSDEDLKR 129

  Fly   137 LQKAYDGLEHCLAEGDYLVGDKLTIADLSCIASVSTAEAFAPIEPDQFPRLVQWVKRIQALPYYQ 201
            ::.|:..|:..|...:|:.||:||:||::.:::|||.|. :..:..::..:.:|....:.:....
  Fly   130 IETAFGFLDTFLEGQEYVAGDQLTVADIAILSTVSTFEV-SEFDFSKYSNVSRWYDNAKKVTPGW 193

  Fly   202 KNNQEGL 208
            ..|.|||
  Fly   194 DENWEGL 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 71/190 (37%)
GST_N_Delta_Epsilon 5..78 CDD:239343 35/69 (51%)
GST_C_Delta_Epsilon 94..211 CDD:198287 32/116 (28%)
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 35/69 (51%)
GST_C_Delta_Epsilon 88..204 CDD:198287 32/116 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460261
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.