DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and eEF1gamma

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster


Alignment Length:229 Identity:51/229 - (22%)
Similarity:87/229 - (37%) Gaps:67/229 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KPILYYAPRSPPCRAVLLTAAALGLELDLRLVNVKAGE-HKSAEFLKLNAQHTIPVLDD-NGTIV 66
            |..||..|.:......|:.|...|.::.: ..|.|.|| :|||||||......:|..:. .|..:
  Fly     3 KGTLYTYPENFRAYKALIAAQYSGAQVKV-ADNFKFGETNKSAEFLKKFPGGKVPAFETAEGQYL 66

  Fly    67 SDSHIICSYLADKYAPEG----------------DDSLYPKDPEKRRLVDARLYYDCGHLFPRIR 115
            |:|:.|...||::....|                |:.:.|.              .|..:||.: 
  Fly    67 SESNAIAYLLANEQLRGGKCPFVQAQVQQWISFADNEIVPA--------------SCAWVFPLL- 116

  Fly   116 FIVEPVIYFGAGEVPSDR--------VAYLQKAYDGLEHCLAEGDYLVGDKLTIADLSCIASVST 172
                       |.:|..:        .|.||:    |...|.:..:|.|:::|:||:...:|:..
  Fly   117 -----------GILPQQKNSTAKQEAEAVLQQ----LNQKLQDATFLAGERITLADIVVFSSLLH 166

  Fly   173 AEAFAPIEP---DQFPRLVQWV------KRIQAL 197
            ...:. :||   ..|..:.:|.      |::||:
  Fly   167 LYEYV-LEPSVRSAFGNVNRWFVTILNQKQVQAV 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 50/228 (22%)
GST_N_Delta_Epsilon 5..78 CDD:239343 23/74 (31%)
GST_C_Delta_Epsilon 94..211 CDD:198287 23/121 (19%)
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 24/75 (32%)
GstA 5..187 CDD:223698 46/213 (22%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 25/141 (18%)
EF1G 271..376 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459958
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.