Sequence 1: | NP_001286575.1 | Gene: | GstE11 / 37128 | FlyBaseID: | FBgn0034354 | Length: | 225 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001002621.1 | Gene: | gsto1 / 436894 | ZFINID: | ZDB-GENE-040718-365 | Length: | 240 | Species: | Danio rerio |
Alignment Length: | 227 | Identity: | 54/227 - (23%) |
---|---|---|---|
Similarity: | 84/227 - (37%) | Gaps: | 76/227 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 LYYAPRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLD-DNGTIVSDSH 70
Fly 71 IICSYLADKYAPEGDDSLYPKDP----EKRRLVDARLYYDCGHLFPRIRFIVEPVIYFGAGEVPS 131
Fly 132 DRVAYLQKAYD--GLEHCLAE-------------GDYLVGDKLTIADL---------------SC 166
Fly 167 IASVSTAEAFAPIEPDQFPRLVQWVKRIQALP 198 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE11 | NP_001286575.1 | GstA | 5..198 | CDD:223698 | 53/225 (24%) |
GST_N_Delta_Epsilon | 5..78 | CDD:239343 | 22/71 (31%) | ||
GST_C_Delta_Epsilon | 94..211 | CDD:198287 | 25/135 (19%) | ||
gsto1 | NP_001002621.1 | GST_N_Omega | 4..93 | CDD:239353 | 21/70 (30%) |
GstA | 25..210 | CDD:223698 | 53/225 (24%) | ||
GST_C_Omega | 107..229 | CDD:198293 | 25/139 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589490 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |