DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and clic2

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001002561.2 Gene:clic2 / 436834 ZFINID:ZDB-GENE-040718-299 Length:239 Species:Danio rerio


Alignment Length:187 Identity:43/187 - (22%)
Similarity:73/187 - (39%) Gaps:49/187 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHT-IPVLDDNGTIVSDSHIICSYLA 77
            |.|:.:.:.....|::..:..|:::    |..:.||..|..| .|.|..|||:.:|...|..:|.
Zfish    30 PFCQRLFMVLWLKGVKFTVTTVDMR----KKPDELKDLAPGTNPPFLLYNGTLKTDFIKIEEFLE 90

  Fly    78 DKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLFPRIR--FIVEPVIY--FGAGEVPSDRVAYLQ 138
            ...||       |:.|               ||.||.:  |.|...|:  |.|....|...|:.:
Zfish    91 TTLAP-------PRYP---------------HLSPRYKESFDVGADIFAKFSAFIKNSPNNAFHE 133

  Fly   139 KA----------------YDGLEH--CLAEGDYLVGDKLTIADLSCIASVSTAEAFA 177
            ||                .|.|:.  .:::..:|.|::||:||.:.:..:...:..|
Zfish   134 KALLREFKRLDDYLNTPLQDELDQNISVSKRKFLDGNRLTLADCNLLPKLHVIKVAA 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 43/187 (23%)
GST_N_Delta_Epsilon 5..78 CDD:239343 17/64 (27%)
GST_C_Delta_Epsilon 94..211 CDD:198287 22/106 (21%)
clic2NP_001002561.2 O-ClC 11..238 CDD:129941 43/187 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589575
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.