DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and GstD11

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster


Alignment Length:217 Identity:78/217 - (35%)
Similarity:116/217 - (53%) Gaps:11/217 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PILYYAPRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSDS 69
            |:|||.|.|||||::||.|..|.::.:|::||:..||....:|:.:|.||.:|.::|.|.::.:|
  Fly    25 PVLYYLPPSPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDEGLVLWES 89

  Fly    70 HIICSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLFPRIRFIVEPVIYFGAGEVPSD-- 132
            ..|.|||...|..  .|.|||.|...|.|||.||.:|.|.|:.|:.....|.::.||   |.|  
  Fly    90 RAILSYLVAAYGK--SDQLYPTDIRVRALVDQRLQFDLGTLYMRLTDYYFPTMFIGA---PLDEG 149

  Fly   133 RVAYLQKAYDGLEHCLAEGDYLVGDKLTIADLSCIASVSTAEAFAPIEPDQFPRLVQWVKRIQ-- 195
            :.|.|.:|...|...|....:...|..|||||:.:.:||..||| ..|...:..:.||:.|.:  
  Fly   150 KRAKLAEAVGWLNTILEGRQFSAADHFTIADLTLLVTVSQLEAF-EFELRPYKHIRQWLDRCKDH 213

  Fly   196 ALPY-YQKNNQEGLDMLVGLVK 216
            ..|: |::.|....:||..:.|
  Fly   214 MAPFDYEELNANKANMLADMFK 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 72/196 (37%)
GST_N_Delta_Epsilon 5..78 CDD:239343 31/72 (43%)
GST_C_Delta_Epsilon 94..211 CDD:198287 38/121 (31%)
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 31/72 (43%)
GST_C_Delta_Epsilon 112..231 CDD:198287 39/122 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
98.970

Return to query results.
Submit another query.