DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and GstD1

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster


Alignment Length:199 Identity:80/199 - (40%)
Similarity:124/199 - (62%) Gaps:9/199 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YYAPRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSDSHII 72
            ||.|.|.|||:|::||.|:|:||:.:|:|::||||...||||:|.|||||.|.|||..:.:|..|
  Fly     5 YYLPGSSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWESRAI 69

  Fly    73 CSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLFPRIRFIVEPVIYFGAGEVPSDRVAY- 136
            ..||.:||..  .||||||.|:||.:::.|||:|.|.|:........|.::   .:.|:|..|: 
  Fly    70 QVYLVEKYGK--TDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVF---AKAPADPEAFK 129

  Fly   137 -LQKAYDGLEHCLAEGDYLVGDKLTIADLSCIASVSTAEAFAPIEPDQFPRLVQWVKRIQAL-PY 199
             ::.|::.|...|...||..||.||:||::.:|:|||.|. |..|..::..:.:|.:..:.: |.
  Fly   130 KIEAAFEFLNTFLEGQDYAAGDSLTVADIALVATVSTFEV-AKFEISKYANVNRWYENAKKVTPG 193

  Fly   200 YQKN 203
            :::|
  Fly   194 WEEN 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 78/192 (41%)
GST_N_Delta_Epsilon 5..78 CDD:239343 38/69 (55%)
GST_C_Delta_Epsilon 94..211 CDD:198287 33/113 (29%)
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 38/69 (55%)
GstA 4..185 CDD:223698 78/185 (42%)
GST_C_Delta_Epsilon 89..205 CDD:198287 33/113 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460248
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.