DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and MARS1

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_004981.2 Gene:MARS1 / 4141 HGNCID:6898 Length:900 Species:Homo sapiens


Alignment Length:226 Identity:47/226 - (20%)
Similarity:83/226 - (36%) Gaps:48/226 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LYYAPRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLD-DNGTIVSDSH 70
            |:.:...|.|..||..|.......:: |::....|.....||   .:..:|||. |:|..:..:.
Human     3 LFVSDGVPGCLPVLAAAGRARGRAEV-LISTVGPEDCVVPFL---TRPKVPVLQLDSGNYLFSTS 63

  Fly    71 IICSYLADKYAPEGDDS----LYPKDPEKRRLVDARLYYDCGHLFPRIRFIVEPVIYFGAGEVPS 131
            .||.|.......|.||.    |..:..|.:..:.|.|||          .:|:       |:...
Human    64 AICRYFFLLSGWEQDDLTNQWLEWEATELQPALSAALYY----------LVVQ-------GKKGE 111

  Fly   132 DRVAYLQKAYDGLEHCLAEGD--YLVGDKLTIADLSCIASVSTAEAFAPIEPDQFPRLVQWVKRI 194
            |.:..:::|...::|.|:..:  :|.|:..::||:....::..........|::...|..|.:.:
Human   112 DVLGSVRRALTHIDHSLSRQNCPFLAGETESLADIVLWGALYPLLQDPAYLPEELSALHSWFQTL 176

  Fly   195 Q-------------------AL-PYYQKNNQ 205
            .                   || ||.||..|
Human   177 STQEPCQRAAETVLKQQGVLALRPYLQKQPQ 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 42/217 (19%)
GST_N_Delta_Epsilon 5..78 CDD:239343 18/71 (25%)
GST_C_Delta_Epsilon 94..211 CDD:198287 25/134 (19%)
MARS1NP_004981.2 Thioredoxin_like <27..68 CDD:294274 11/44 (25%)
GstA <47..189 CDD:223698 30/158 (19%)
GST_C_MetRS_N 77..179 CDD:198340 21/118 (18%)
PRK12268 264..819 CDD:237029
MetRS_core 265..633 CDD:173907
'HIGH' region 273..283
'KMSKS' region 593..597
Anticodon_Ia_Met 642..771 CDD:153411
MetRS_RNA 845..889 CDD:238475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.