DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and GstZ1

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster


Alignment Length:224 Identity:58/224 - (25%)
Similarity:103/224 - (45%) Gaps:47/224 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAKPILY-YAPRSPPCRAVLLTAAALGLELDLR---LVNVKAGEHKSAEFLKLNAQHTIPVLDD 61
            ::.||||| |.|.|...| |.:..|...::.|::   |:...:|...:.|:.::|....:|.|..
  Fly    30 LATKPILYSYWPSSCSWR-VRVALAIKKIDYDIKPTSLLKTVSGHAYTDEYREVNPMQKVPSLKI 93

  Fly    62 NGTIVSDSHIICSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLFPRIRFIVEPVIYFGA 126
            :|..:.||..|..|| ::..|:  .:|.|:||.||               .:||.|||.:.   :
  Fly    94 DGHTLCDSVAIIHYL-EETRPQ--PALLPQDPVKR---------------AKIREIVELIC---S 137

  Fly   127 GEVPSDRVA----------------YLQKAYDGLEHCLAE--GDYLVGDKLTIADLSCIASVSTA 173
            |..|...|:                ::.:.:.|||..|:.  |.:.|||:|::||:..:..|..|
  Fly   138 GIQPLQNVSVLDHIGKDQSLQWAQHWISRGFQGLEKVLSHSAGKFCVGDELSMADICLVPQVRNA 202

  Fly   174 EAF-APIEPDQFPRLVQWVKRIQALPYYQ 201
            ..: |.:.|  :|.:|:..:.:|.|..::
  Fly   203 RRYKADLTP--YPTIVRLNQELQELDVFK 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 56/215 (26%)
GST_N_Delta_Epsilon 5..78 CDD:239343 23/76 (30%)
GST_C_Delta_Epsilon 94..211 CDD:198287 29/127 (23%)
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 23/76 (30%)
maiA 35..240 CDD:273527 56/219 (26%)
GST_C_Zeta 122..236 CDD:198300 30/128 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460420
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.