DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and clic5b

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_998062.1 Gene:clic5b / 405833 ZFINID:ZDB-GENE-040426-2542 Length:408 Species:Danio rerio


Alignment Length:170 Identity:41/170 - (24%)
Similarity:57/170 - (33%) Gaps:47/170 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VKAGEHKSAEFL----------KLNAQHTIPVLDDNGTIVSDSHIICS----------------- 74
            ||...:|..|||          ||.|:|.......|......|..|.:                 
Zfish   239 VKTDVNKIEEFLEEVLAPPKYPKLAARHRESNAAGNDIFAKFSAFIKNTKPDANEALEKGLTKAL 303

  Fly    75 -----YLADKYAPEGD-DSLYPKDPEKRRLVDAR--LYYDCGHLFPRIRFIVEPVIYFGAGEVPS 131
                 ||......|.| ||:..:....||.:|..  ...|| :|.|::..:......:...::||
Zfish   304 KKLDEYLNSPLPDEVDADSMEEEKASNRRFLDGNDLTLADC-NLLPKLHIVKVVAKKYRNFDIPS 367

  Fly   132 DRVA---YLQKAYDGLEH---CLAEGD----YL-VGDKLT 160
            |...   ||..||...|.   |.|:.:    || |..:||
Zfish   368 DLTGVWRYLNSAYAQEEFTNTCAADNEIESAYLDVAKRLT 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 41/170 (24%)
GST_N_Delta_Epsilon 5..78 CDD:239343 15/72 (21%)
GST_C_Delta_Epsilon 94..211 CDD:198287 22/80 (28%)
clic5bNP_998062.1 GST_N_CLIC 170..259 CDD:239359 6/19 (32%)
O-ClC 172..407 CDD:129941 39/168 (23%)
GST_C_CLIC5 266..406 CDD:198330 30/140 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589735
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.