DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and gstt1b

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_956878.1 Gene:gstt1b / 393556 ZFINID:ZDB-GENE-040426-1491 Length:242 Species:Danio rerio


Alignment Length:202 Identity:56/202 - (27%)
Similarity:94/202 - (46%) Gaps:32/202 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSDSHIICSYLA 77
            |.|||:|.:.|....::.|.:.:::..|.....||.|:|.....|.:.|....:::|..|..|||
Zfish    11 SQPCRSVYIFAKKNNIQFDYKKISLFEGYQYGEEFGKINPLRKFPTIKDGDFCLAESVAIMIYLA 75

  Fly    78 DKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLFPRIRFIVEPVIYF--------GAGEVPSDRV 134
            ||:  ...|..:|.|.:||..|:..|.:.    ...||.....:|:|        || |||.:: 
Zfish    76 DKF--HTPDHWFPADLQKRARVNEYLSWQ----HTSIRMHGAKIIWFKILIPEVLGA-EVPKEK- 132

  Fly   135 AYLQKAYDGL--------EHCLAEGDYLVGDKLTIADLSCIASVSTAEAFAPIEPDQF---PRLV 188
              ::.|.:.|        :..|.:..::|||::::|||  :|.|...:.|| ...|.|   |:|.
Zfish   133 --MENAEENLNVALQLFQDKFLQDKPFIVGDQISLADL--VAIVEIMQPFA-AGMDVFENRPKLK 192

  Fly   189 QWVKRIQ 195
            .|..|::
Zfish   193 AWKDRVR 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 56/202 (28%)
GST_N_Delta_Epsilon 5..78 CDD:239343 18/64 (28%)
GST_C_Delta_Epsilon 94..211 CDD:198287 32/121 (26%)
gstt1bNP_956878.1 GstA 1..199 CDD:223698 56/200 (28%)
GST_N_Theta 3..78 CDD:239348 20/66 (30%)
GST_C_Theta 91..217 CDD:198292 32/120 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10727
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.