DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and gstt2

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_956815.2 Gene:gstt2 / 393493 ZFINID:ZDB-GENE-040426-1617 Length:228 Species:Danio rerio


Alignment Length:201 Identity:66/201 - (32%)
Similarity:99/201 - (49%) Gaps:28/201 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSDSHIICSYLA 77
            |.||||||:......:...:..:.::.||.|:.||.|||....:|||:|||.::::|..|..|||
Zfish    15 SQPCRAVLIFLKHNKIPHTVEQIAIRKGEQKTPEFTKLNPMQKVPVLEDNGFVLTESDAILKYLA 79

  Fly    78 DKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLFPRIR----FIVEPVIYFGAGEVPSDRVAYLQ 138
            ..|  :..|..|||.||||..||.  |....|:..|:.    |..|.::....|: |:: .|.|:
Zfish    80 TTY--KVPDHWYPKLPEKRARVDE--YTAWHHMNTRMHAATVFWQEVLLPLMTGQ-PAN-TAKLE 138

  Fly   139 KA-------YDGLEHC-LAEGDYLVGDKLTIADLSCIASVSTAEAFAPIEPDQ-----FPRLVQW 190
            ||       .|.||:. |....:|.||.:::|||..|     .|...|:...:     .|:|:.|
Zfish   139 KALSDLSGTLDKLENMFLKRQAFLCGDDISLADLLAI-----CELMQPMSSGRDILKDRPKLLSW 198

  Fly   191 VKRIQA 196
            ..|:|:
Zfish   199 RSRVQS 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 66/201 (33%)
GST_N_Delta_Epsilon 5..78 CDD:239343 25/64 (39%)
GST_C_Delta_Epsilon 94..211 CDD:198287 34/120 (28%)
gstt2NP_956815.2 GST_N_Theta 7..82 CDD:239348 26/66 (39%)
GST_C_Theta 95..220 CDD:198292 33/119 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589548
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.