DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and GstO2

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster


Alignment Length:150 Identity:36/150 - (24%)
Similarity:61/150 - (40%) Gaps:26/150 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 IPVLD-----DNGTIVSDSHIICSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLFPRIR 115
            :|.|.     |..|:| :|.||..||..:| |:  ..|:|.||.::.| |..|.    ..|..:.
  Fly    71 VPALQLTGVKDQPTLV-ESLIIAEYLDQQY-PQ--TRLFPTDPLQKAL-DKILI----ERFAPVV 126

  Fly   116 FIVEPVIYFGAGEVPSDRVAYLQKAYDGLEHCLAE--GDYLVGDKLTIADLSC--------IASV 170
            ..:.||:.... ..|.|.:...:.|.|..|..|.:  ..|..|..:.|.|...        ...:
  Fly   127 SAIYPVLTCNP-NAPKDAIPNFENALDVFEVELGKRGTPYFAGQHIGIVDYMIWPWFERFPSMKI 190

  Fly   171 STAEAFAPIEPDQFPRLVQW 190
            :|.:.: .::..:|.:|::|
  Fly   191 NTEQKY-ELDTKRFEKLLKW 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 35/149 (23%)
GST_N_Delta_Epsilon 5..78 CDD:239343 10/26 (38%)
GST_C_Delta_Epsilon 94..211 CDD:198287 19/106 (18%)
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 9/25 (36%)
GstA 25..215 CDD:223698 35/149 (23%)
GST_C_Omega 110..235 CDD:198293 19/106 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460210
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.