DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and se

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster


Alignment Length:168 Identity:43/168 - (25%)
Similarity:74/168 - (44%) Gaps:36/168 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LKLNAQHTIPVL----DDNGTIVSDSHIICSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCG 108
            |:.|.|..:|.|    :....::::|.:||.||.::|...   .|||:||.|:  |..:|     
  Fly    62 LEKNPQGKVPALEIVREPGPPVLTESLLICEYLDEQYPLR---PLYPRDPLKK--VQDKL----- 116

  Fly   109 HLFPRIRFIVEPVIYFGAGEVPSDRVAYLQKAYDGL---EHCLAE--GDYLVGDKLTIADLS--- 165
             |..|.|.::      ||....||. ..|:..:.||   |..||.  .::..|::..|.|..   
  Fly   117 -LIERFRAVL------GAFFKASDG-GDLEPFWSGLDIYERELARRGTEFFGGEQTGILDYMIWP 173

  Fly   166 -C----IASVSTAEAFAPIEPDQFPRLVQWVKRIQALP 198
             |    :..:...|.: ..:..:||:|..|::|::..|
  Fly   174 WCERLELLKLQRGEDY-NYDQSRFPQLTLWLERMKRDP 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 42/166 (25%)
GST_N_Delta_Epsilon 5..78 CDD:239343 10/33 (30%)
GST_C_Delta_Epsilon 94..211 CDD:198287 27/118 (23%)
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 9/32 (28%)
GstA 22..215 CDD:223698 43/168 (26%)
GST_C_Omega 109..229 CDD:198293 27/118 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460171
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.