DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and GstO3

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster


Alignment Length:213 Identity:44/213 - (20%)
Similarity:78/213 - (36%) Gaps:73/213 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LRLVNVKAGEHKSAEFLKLNAQHT------------------------IPVL----DDNGTIVSD 68
            |||.:::...:.....|.|||::.                        :|.|    :.....:.:
  Fly    22 LRLYSMRFCPYAQRAHLVLNAKNVPYHSVYINLTEKPEWLVEVSPLLKVPALQLVAEKGEPSLIE 86

  Fly    69 SHIICSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLFPRIRFIVEPVI----------- 122
            |.||..||.||| ||  :.|.||||.||  ...::      |..|...|....|           
  Fly    87 SLIIAEYLDDKY-PE--NPLLPKDPLKR--AQDKI------LLERFSSITSAFINILVQGTGLED 140

  Fly   123 YFGAGEVPSDRVAYLQKAYDGLEHCLAEG------DYLVG---DKLTIADLSCIASVSTAEAFAP 178
            |:.|.::..:.:......|.|       |      ||::.   ::|::.:|......:..|:   
  Fly   141 YWTALDIFEEELTKRGTPYFG-------GNKPGFVDYMIWPWFERLSVIELKLQKEYNFNES--- 195

  Fly   179 IEPDQFPRLVQWVKRIQA 196
                :||::.:|:..::|
  Fly   196 ----RFPKITKWIALLKA 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 44/213 (21%)
GST_N_Delta_Epsilon 5..78 CDD:239343 14/73 (19%)
GST_C_Delta_Epsilon 94..211 CDD:198287 20/123 (16%)
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 13/72 (18%)
GstA 22..209 CDD:223698 43/211 (20%)
GST_C_Omega 109..230 CDD:198293 20/123 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460184
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.