DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and Gr59f

DIOPT Version :10

Sequence 1:NP_611339.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster


Alignment Length:43 Identity:10/43 - (23%)
Similarity:18/43 - (41%) Gaps:15/43 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 IASVSTAEAFAPIEPDQFPRLVQWVKRIQALPYYQKNNQEGLD 209
            |:|:|.|               |:...:|.:.:.|:...|||:
  Fly   195 ISSISFA---------------QYYLLLQGIAWRQRRLTEGLE 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_611339.1 GST_N_Delta_Epsilon 5..78 CDD:239343
GST_C_Delta_Epsilon 94..211 CDD:198287 10/43 (23%)
Gr59fNP_788432.1 7tm_7 61..388 CDD:473258 10/43 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.