DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and GstE8

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster


Alignment Length:215 Identity:87/215 - (40%)
Similarity:127/215 - (59%) Gaps:3/215 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AKPILYYAPRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVS 67
            :|.|||....|||.||..||.||||:..:...:|..|.|..|.|||:.|.|||:|.|:|:|..:.
  Fly     2 SKLILYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFIW 66

  Fly    68 DSHIICSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLFPR-IRFIVEPVIYFGAGEVPS 131
            |||.|.:||..||..  .|:|||||..:|.:||.||:::.|.:|.. :|.|.:|:...|...:|.
  Fly    67 DSHAISAYLVSKYGQ--SDTLYPKDLLQRAVVDQRLHFESGVVFVNGLRGITKPLFATGQTTIPK 129

  Fly   132 DRVAYLQKAYDGLEHCLAEGDYLVGDKLTIADLSCIASVSTAEAFAPIEPDQFPRLVQWVKRIQA 196
            :|...:.:.||.:|..|...|::.||:|||||.|.|.|::....|..|:..::..:..|:|||:.
  Fly   130 ERYDAVIEIYDFVETFLTGHDFIAGDQLTIADFSLITSITALAVFVVIDTVKYANITAWIKRIEE 194

  Fly   197 LPYYQKNNQEGLDMLVGLVK 216
            ||||::...:|...||.|:|
  Fly   195 LPYYEEACGKGARDLVTLLK 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 77/193 (40%)
GST_N_Delta_Epsilon 5..78 CDD:239343 35/72 (49%)
GST_C_Delta_Epsilon 94..211 CDD:198287 39/117 (33%)
GstE8NP_001286571.1 GstA 4..196 CDD:223698 77/193 (40%)
GST_N_Delta_Epsilon 4..77 CDD:239343 35/72 (49%)
GST_C_Delta_Epsilon 91..209 CDD:198287 39/117 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468019
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.