DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and GstE1

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster


Alignment Length:217 Identity:87/217 - (40%)
Similarity:125/217 - (57%) Gaps:3/217 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAKPILYYAPRSPPC-RAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGT 64
            ||:..|:.|.....|| |.|.||...|.|:.:.:.||::||||.|.|::|.|.|||:|:||||||
  Fly     1 MSSSGIVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGT 65

  Fly    65 IVSDSHIICSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLFPRIRFIVEPVIYFGAGEV 129
            .:.|||.|.:||.||||.  .|.|||||..||.:|:.||::|...::..|..:..|....|..||
  Fly    66 FIWDSHAIAAYLVDKYAK--SDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTEV 128

  Fly   130 PSDRVAYLQKAYDGLEHCLAEGDYLVGDKLTIADLSCIASVSTAEAFAPIEPDQFPRLVQWVKRI 194
            |.:::..:.:....||..|....||.||.||:||||...:||...|...|:|..:|::..|:.|:
  Fly   129 PQEKLDAVHQGLKLLETFLGNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDPATYPKVTAWLDRL 193

  Fly   195 QALPYYQKNNQEGLDMLVGLVK 216
            ..||||::.|:......|..::
  Fly   194 NKLPYYKEINEAPAQSYVAFLR 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 79/193 (41%)
GST_N_Delta_Epsilon 5..78 CDD:239343 36/73 (49%)
GST_C_Delta_Epsilon 94..211 CDD:198287 38/116 (33%)
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 36/72 (50%)
GstA 8..197 CDD:223698 78/190 (41%)
GST_C_Delta_Epsilon 94..210 CDD:198287 38/115 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468026
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.