DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and GstE14

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster


Alignment Length:212 Identity:78/212 - (36%)
Similarity:117/212 - (55%) Gaps:12/212 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KPILYYAPRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSD 68
            ||||||..||||.|:.|:....|.::::||.||:..||....:||.||.||::|.|.....:::|
  Fly     5 KPILYYDERSPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDLVLTD 69

  Fly    69 SHIICSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLFPRIRFIVEPVIYFGAGEVPSDR 133
            ||.|..:||:|:...|  ||:|::..:|..|...|.::|..||.|....:...:..|...|.   
  Fly    70 SHAILIHLAEKFDEGG--SLWPQEHAERMKVLNLLLFECSFLFRRDSDFMSATVRQGFANVD--- 129

  Fly   134 VAY----LQKAYDGLEHCLAEGDYLVGDKLTIADLSCIASVSTAEAFAPIEPDQFPRLVQWVKRI 194
            ||:    |.:||..:|..|...|::.|.:||:||||.:.::||.....|:  .|||||.:|...:
  Fly   130 VAHHERKLTEAYIIMERYLENSDFMAGPQLTLADLSIVTTLSTVNLMFPL--SQFPRLRRWFTAM 192

  Fly   195 QALPYYQKNNQEGLDML 211
            |.|..|:. |..||:.|
  Fly   193 QQLDAYEA-NCSGLEKL 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 71/196 (36%)
GST_N_Delta_Epsilon 5..78 CDD:239343 31/72 (43%)
GST_C_Delta_Epsilon 94..211 CDD:198287 39/120 (33%)
GstE14NP_610855.1 GstA 6..200 CDD:223698 73/200 (37%)
GST_N_Delta_Epsilon 6..79 CDD:239343 31/72 (43%)
GST_C_Delta_Epsilon 94..209 CDD:198287 40/121 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
98.970

Return to query results.
Submit another query.