DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and GstT1

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster


Alignment Length:215 Identity:59/215 - (27%)
Similarity:96/215 - (44%) Gaps:31/215 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YYAPRSPPCRAVLLTAAALG-LELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSDSHI 71
            ||...|.|.|| |..|..|| ...:...|.::..|..:.|:..:|....:|.:.|....:.:|..
  Fly     8 YYDFLSQPSRA-LWIAMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAIVDGKFQLGESVS 71

  Fly    72 ICSYLADKYAPEG--DDSLYPKDPEKRRLVDARLYYD-------CGHLFPRIRFIVEPVIYFGAG 127
            |..|||||    |  .:.||||..|:|..||..|.:.       |...|.::..:.      ..|
  Fly    72 IVRYLADK----GVFSEQLYPKTLEERARVDEFLEWQHFNVRLVCSLFFRQVWLLP------AKG 126

  Fly   128 EVPSDRVAYLQKAYDGLEHCLA-------EGDYLVGDKLTIADLSCIASVSTAEAFA-PIEPDQF 184
            ..|:.:...::|....:|..|.       |.|:|||||||:||:...:.::..:... .:...||
  Fly   127 LAPAPKPESVKKLIKDVESNLGLLERLWLEKDFLVGDKLTVADIFGSSEINQMKLCQYNVNEKQF 191

  Fly   185 PRLVQWVKRIQ--ALPYYQK 202
            |::.:|::|::  ..|||.:
  Fly   192 PKVAKWMERVRDATNPYYDE 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 56/209 (27%)
GST_N_Delta_Epsilon 5..78 CDD:239343 20/70 (29%)
GST_C_Delta_Epsilon 94..211 CDD:198287 31/126 (25%)
GstT1NP_610509.2 GstA 5..204 CDD:223698 56/206 (27%)
GST_N_Theta 5..80 CDD:239348 23/76 (30%)
GST_C_Theta 93..218 CDD:198292 30/125 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460109
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.