DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and clic1

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_997847.1 Gene:clic1 / 324481 ZFINID:ZDB-GENE-030131-3202 Length:241 Species:Danio rerio


Alignment Length:145 Identity:31/145 - (21%)
Similarity:54/145 - (37%) Gaps:38/145 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNA--QHTIPVLDDN---GTIVS--- 67
            ||...|.....||   ||::                |.|.:|  :::.|.::||   |.:.:   
Zfish    94 PRLAACNPESNTA---GLDV----------------FSKFSAYIKNSNPQMNDNLEKGLLKALKK 139

  Fly    68 -DSHIICSYLADKYAPEGDDSLYPKDPEKRRLVDAR--LYYDCGHLFPRIRFIVEPVIYFGAGEV 129
             |.: :.|.|.|:......|.:.   ...|..:|.:  ...|| :|.|::..:....:.|....:
Zfish   140 LDDY-LSSPLPDEIDENSADDVI---SSTRSFLDGQELTLADC-NLLPKLHIVKVVCLKFRGFSI 199

  Fly   130 PSDRVA---YLQKAY 141
            |....:   ||..||
Zfish   200 PRSLTSLWRYLDAAY 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 31/145 (21%)
GST_N_Delta_Epsilon 5..78 CDD:239343 17/75 (23%)
GST_C_Delta_Epsilon 94..211 CDD:198287 12/53 (23%)
clic1NP_997847.1 GST_N_CLIC 3..93 CDD:239359
O-ClC 6..241 CDD:129941 31/145 (21%)
GST_C_CLIC1 100..238 CDD:198333 28/139 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589708
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.