DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and Gdap1

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001101367.1 Gene:Gdap1 / 312890 RGDID:1309005 Length:358 Species:Rattus norvegicus


Alignment Length:289 Identity:59/289 - (20%)
Similarity:99/289 - (34%) Gaps:90/289 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILYYAPRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSDSH 70
            |||:...|...:.|.|..|...|:.:...|::...||....|::||:...:|||.....|:.::.
  Rat    27 ILYHWTHSFSSQKVRLVIAEKALKCEEHDVSLPLSEHNEPWFMRLNSTGEVPVLIHGENIICEAT 91

  Fly    71 IICSYLADKY--------APEGDDSLYPKDPEKRRLVDA-------------------------- 101
            .|..||...:        .|:.....||:....|.|:|:                          
  Rat    92 QIIDYLEQTFLDERTPRLMPDEGSMYYPRVQHYRELLDSLPMDAYTHGCILHPELTVDSMIPAYA 156

  Fly   102 --RLYYDCGHLFPRIRFIVEPVIYFGAGEVPS-------------------DRVAYLQKAYDGLE 145
              |:....|:....::.:.|        |.|.                   |.|.||:|..|.||
  Rat   157 TTRIRGQIGNTESELKKLAE--------ENPDLQEAYIAKQKRLKSKLLDHDNVKYLKKILDELE 213

  Fly   146 HCL---------------AEGD--YLVGDKLTIADLSCIASVSTAEAFAPIEPDQFPRLVQW--V 191
            ..|               .||:  :|.|:..|:||:|...::...:...      |.|. .|  .
  Rat   214 KVLDQVETELQRRNEETPDEGNQPWLCGESFTLADVSLAVTLHRLKFLG------FARR-NWGHG 271

  Fly   192 KRIQALPYYQK-NNQEGLDMLVGLVKGLL 219
            ||.....||:: ..::..:.::|.|..:|
  Rat   272 KRPNLESYYERVLKRKTFNKVLGHVNNIL 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 54/265 (20%)
GST_N_Delta_Epsilon 5..78 CDD:239343 21/71 (30%)
GST_C_Delta_Epsilon 94..211 CDD:198287 32/183 (17%)
Gdap1NP_001101367.1 GstA 26..292 CDD:223698 56/279 (20%)
GST_N_GDAP1 26..98 CDD:239350 20/70 (29%)
GST_C_GDAP1 179..289 CDD:198336 25/116 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348322
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.