DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and Clic6

DIOPT Version :10

Sequence 1:NP_611339.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_788267.2 Gene:Clic6 / 304081 RGDID:727938 Length:613 Species:Rattus norvegicus


Alignment Length:191 Identity:39/191 - (20%)
Similarity:66/191 - (34%) Gaps:60/191 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LGLELDLRLVNVKAG---------------------------------EHKSAEFLKLNAQHTIP 57
            ||.|.|:.|. ||||                                 :.|.|:...|......|
  Rat   374 LGQEHDITLF-VKAGSDGESIGNCPFSQRLFMILWLKGVIFNVTTVDLKRKPADLQNLAPGTNPP 437

  Fly    58 VLDDNGTIVSDSHIICSYLADKYAPEGDDSLYPKDPE----------------KRRLVDARLYYD 106
            .:..:|.:.:|.:.|..:|.:|..|.....|..:.||                |....||...|:
  Rat   438 FMTFDGEVKTDVNKIEEFLEEKLVPPRYPKLGTQHPESNSAGNDVFAKFSAFIKNTKKDANDIYE 502

  Fly   107 CGHLFPRIRFIVEPVIYFGAGEVPSDRVAYLQKAYDGLEHCLAEGDYLVGDKLTIADLSCI 167
            ...|    |.:.:...|..: .:|.:..||..:     :..:::..:|.||:||:||.:.:
  Rat   503 KNLL----RALKKLDSYLNS-PLPDEIDAYSTE-----DVTVSQRKFLDGDELTLADCNLL 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_611339.1 GST_N_Delta_Epsilon 5..78 CDD:239343 17/84 (20%)
GST_C_Delta_Epsilon 94..211 CDD:198287 18/90 (20%)
Clic6NP_788267.2 2A1904 <51..318 CDD:273344
O-ClC 380..613 CDD:129941 35/185 (19%)
G-site. /evidence=ECO:0000250|UniProtKB:Q9Y696 396..399 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.