DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and Clic4

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_038913.1 Gene:Clic4 / 29876 MGIID:1352754 Length:253 Species:Mus musculus


Alignment Length:185 Identity:30/185 - (16%)
Similarity:55/185 - (29%) Gaps:65/185 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSDSHIICSYLADKYAPEGDDSLYPK 91
            |:...:..|::|   .|.|:...|......|.:..|..:.:|.:.|..:|.:...|.....|.||
Mouse    49 GVVFSVTTVDLK---RKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPK 110

  Fly    92 DPEKRRLVDARLYYDCGHLFPRIRFIVEPVIYFGAG-EVPSDRVAYLQKAYDGLEHCLAEG---- 151
            .||...                            || ::.:...||::.:.......|..|    
Mouse   111 HPESNT----------------------------AGMDIFAKFSAYIKNSRPEANEALERGLLKT 147

  Fly   152 -----------------------------DYLVGDKLTIADLSCIASVSTAEAFA 177
                                         .:|.||::|:||.:.:..:...:..|
Mouse   148 LQKLDEYLNSPLPDEIDENSMEDIKFSTRRFLDGDEMTLADCNLLPKLHIVKVVA 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 30/185 (16%)
GST_N_Delta_Epsilon 5..78 CDD:239343 11/50 (22%)
GST_C_Delta_Epsilon 94..211 CDD:198287 14/118 (12%)
Clic4NP_038913.1 Required for insertion into the membrane. /evidence=ECO:0000250 2..101 11/54 (20%)
O-ClC 17..252 CDD:129941 30/185 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844486
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.