DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and GSTZ1

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001350632.1 Gene:GSTZ1 / 2954 HGNCID:4643 Length:217 Species:Homo sapiens


Alignment Length:211 Identity:62/211 - (29%)
Similarity:96/211 - (45%) Gaps:24/211 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SAKPILYYAPRSPPCRAVLLTAAALGLELDLRLVNV--KAGEHKSAEFLKLNAQHTIPVLDDNGT 64
            |.|||||...||.....|.:..|..|::.:...:|:  ..|:..|.:|..||....:|.|..:|.
Human     4 SGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKIDGI 68

  Fly    65 IVSDSHIICSYLAD-KYAPEGDDSLYPKDPEKRRLVDARLYYD--CGHLFPRIRFIVEPVIYFGA 126
            .:..|..|..||.: :..|.    |.|:||:||..|  |:..|  .|.:.|.....|...:    
Human    69 TIHQSLAIIEYLEEMRPTPR----LLPQDPKKRASV--RMISDLIAGGIQPLQNLSVLKQV---- 123

  Fly   127 GEVPSDRVAYLQKA----YDGLEHCL--AEGDYLVGDKLTIADLSCIASVSTAEAFAPIEPDQFP 185
            ||  ..::.:.|.|    ::.||..|  ..|.|.|||::|:|||..:..|:.||.| .::...:|
Human   124 GE--EMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERF-KVDLTPYP 185

  Fly   186 RLVQWVKRIQALPYYQ 201
            .:....||:..|..:|
Human   186 TISSINKRLLVLEAFQ 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 58/203 (29%)
GST_N_Delta_Epsilon 5..78 CDD:239343 22/74 (30%)
GST_C_Delta_Epsilon 94..211 CDD:198287 33/116 (28%)
GSTZ1NP_001350632.1 maiA 8..212 CDD:273527 59/207 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.