DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and Clic2

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001009651.1 Gene:Clic2 / 294141 RGDID:1306580 Length:245 Species:Rattus norvegicus


Alignment Length:192 Identity:36/192 - (18%)
Similarity:64/192 - (33%) Gaps:53/192 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSDSHIICSYLAD 78
            |.|:.:.:.....|::.::..::.   ..|..|...|......|.|..|..:.:|...|..:|..
  Rat    31 PFCQRLFMILWLKGVKFNVTTIDT---ARKPEELKDLAPGTNPPFLIYNKELKTDFIKIEEFLEK 92

  Fly    79 KYAPEGDDSLYPKDPEKRRLVDARLYYDCG-HLFPRIR--------------------------- 115
            ..||.....|.||..|.         :|.| :||.:..                           
  Rat    93 TLAPPRYPHLSPKYKES---------FDVGCNLFAKFSAYIKNTQKEANKNFEKSLLREFKRLDD 148

  Fly   116 FIVEPVIYFGAGEVPSDRVAYLQKAYDGLEHCLAEGDYLVGDKLTIADLSCIASVSTAEAFA 177
            ::..|::    .|:..|...         |..|:...:|.||:||:||.|.:..::..:..|
  Rat   149 YLNTPLL----DEIDPDSTE---------ERTLSRRLFLDGDQLTLADCSLLPKLNIIKVAA 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 36/192 (19%)
GST_N_Delta_Epsilon 5..78 CDD:239343 12/63 (19%)
GST_C_Delta_Epsilon 94..211 CDD:198287 19/112 (17%)
Clic2NP_001009651.1 Required for insertion into the membrane. /evidence=ECO:0000250 1..96 12/67 (18%)
GST_N_CLIC 9..99 CDD:239359 14/70 (20%)
O-ClC 12..245 CDD:129941 36/192 (19%)
GST_C_CLIC2 106..244 CDD:198331 19/114 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348064
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.