DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and gst-34

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_741060.2 Gene:gst-34 / 260015 WormBaseID:WBGene00001782 Length:218 Species:Caenorhabditis elegans


Alignment Length:159 Identity:40/159 - (25%)
Similarity:69/159 - (43%) Gaps:32/159 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PVLDDNGTIVSDSHIICSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLFPRIRFIVE-- 119
            |||..:|..::.|..|..|||.|:...|      |.||.....|:        :..:::..:|  
 Worm    61 PVLSIDGFDLAQSTAIHRYLARKFGYAG------KSPEDEAFADS--------IVDQVKEYLESF 111

  Fly   120 -PVIYFGAGEVPSDRVAYL-QKAYDGLEHCL----------AEGDYLVGDKLTIADL---SCIAS 169
             |::|......|.:.|..: .:.|..:::.|          ::.:|||||.||.|||   ..:.|
 Worm   112 RPLLYAQKSGKPEEEVKRIHDEVYIPVKNLLFKILTRILKESKSEYLVGDGLTWADLVVADHLYS 176

  Fly   170 VSTAEAFAPIEPDQFPRLVQWVKRIQALP 198
            ::..:...|.:|... .|.::.:||..||
 Worm   177 LTNIKELDPEDPIHL-NLKKYQERIFNLP 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 38/157 (24%)
GST_N_Delta_Epsilon 5..78 CDD:239343 8/20 (40%)
GST_C_Delta_Epsilon 94..211 CDD:198287 27/122 (22%)
gst-34NP_741060.2 GST_N_Sigma_like 4..82 CDD:239337 8/20 (40%)
PTZ00057 6..213 CDD:173353 40/159 (25%)
GST_C_Sigma_like 92..200 CDD:198301 23/116 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.