DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and CLIC4

DIOPT Version :10

Sequence 1:NP_611339.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_039234.1 Gene:CLIC4 / 25932 HGNCID:13518 Length:253 Species:Homo sapiens


Alignment Length:68 Identity:17/68 - (25%)
Similarity:28/68 - (41%) Gaps:3/68 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSDSHIICSYLADKYAPEGDDSLYPK 91
            |:...:..|::|   .|.|:...|......|.:..|..:.:|.:.|..:|.:...|.....|.||
Human    49 GVVFSVTTVDLK---RKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPK 110

  Fly    92 DPE 94
            .||
Human   111 HPE 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_611339.1 GST_N_Delta_Epsilon 5..78 CDD:239343 11/50 (22%)
GST_C_Delta_Epsilon 94..211 CDD:198287 1/1 (100%)
CLIC4NP_039234.1 Required for insertion into the membrane. /evidence=ECO:0000305 2..101 11/54 (20%)
O-ClC 17..252 CDD:129941 17/68 (25%)
G-site. /evidence=ECO:0000250|UniProtKB:Q9Z0W7 35..38
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.