DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and GSTT4

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001345593.1 Gene:GSTT4 / 25774 HGNCID:26930 Length:241 Species:Homo sapiens


Alignment Length:215 Identity:50/215 - (23%)
Similarity:93/215 - (43%) Gaps:46/215 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LYYAPRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSDSHI 71
            ||....|.|||||.:.:....::.:.:.|::..|.|.|..::.:|....:|.|.|...|:|:|..
Human     5 LYMDLLSAPCRAVYIFSKKHDIQFNFQFVDLLKGHHHSKGYIDINPLRKLPSLKDGKFILSESAA 69

  Fly    72 ICSYLADKY-APEGDDSLYPKDPEKRRLVDARLYYDCGH---------------LFPRIRFIVEP 120
            |..||..|| ||   ....|.||..|..||..:.:.  |               |.|:|.     
Human    70 ILYYLCRKYSAP---SHWCPPDPHARARVDEFVAWQ--HTAFQLPMKKIVWLKLLIPKIT----- 124

  Fly   121 VIYFGAGEVPSDRVAY-LQKAYDGL----EHCLAEGDYLVGDKLTIADLSCIASVSTAEAFAPIE 180
                 ..||.::::.: :::..:.|    |:.|.:..::.|:::::|||     |:..|...|:.
Human   125 -----GEEVSAEKMEHAVEEVKNSLQLFEEYFLQDKMFITGNQISLADL-----VAVVEMMQPMA 179

  Fly   181 PD-----QFPRLVQWVKRIQ 195
            .:     ...:|.:|..:::
Human   180 ANYNVFLNSSKLAEWRMQVE 199

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 50/215 (23%)
GST_N_Delta_Epsilon 5..78 CDD:239343 22/70 (31%)
GST_C_Delta_Epsilon 94..211 CDD:198287 21/127 (17%)
GSTT4NP_001345593.1 Thioredoxin_like 3..78 CDD:320948 22/72 (31%)