DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and gst2

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_588517.1 Gene:gst2 / 2539601 PomBaseID:SPCC965.07c Length:230 Species:Schizosaccharomyces pombe


Alignment Length:227 Identity:64/227 - (28%)
Similarity:90/227 - (39%) Gaps:37/227 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LYYAPRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDD---NGTIVSD 68
            ||.....|....|:|....|.|..:....:.:.||.|..|.|.||....:|.|.|   |...:.:
pombe     6 LYSHAGGPNPWKVVLALKELNLSYEQIFYDFQKGEQKCKEHLALNPNGRVPTLVDHKNNDYTIWE 70

  Fly    69 SHIICSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLFPRIRFIVEPVIYFGAG------ 127
            |..|..||||||..:...||...|||..:|:....:...|          :.||:..||      
pombe    71 SDAILIYLADKYDTDRKISLSFDDPEYYKLIQYLFFQASG----------QGVIWGQAGWFNFFH 125

  Fly   128 --EVPSDRVAY---LQKAYDGLEHCLAEGDYLVGDKLTIADLSCI------------ASVSTAEA 175
              .|.|....|   :::....||..|.:.||||.:|.||||||.|            ...|..|.
pombe   126 HEPVVSAVTRYRNEIKRVLGVLEDILKDRDYLVANKYTIADLSFIPWNYNLGGLFGEGKFSFKEE 190

  Fly   176 FAPIE-PDQFPRLVQWVKRIQALPYYQKNNQE 206
            ...:: ..:||:...|.:|:.|.|..:...:|
pombe   191 VPQLDFEKEFPKAYAWNQRLLARPAVKATFEE 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 62/217 (29%)
GST_N_Delta_Epsilon 5..78 CDD:239343 22/73 (30%)
GST_C_Delta_Epsilon 94..211 CDD:198287 34/137 (25%)
gst2NP_588517.1 GST_N_Ure2p_like 4..84 CDD:239346 26/77 (34%)
GstA 5..226 CDD:223698 64/227 (28%)
GST_C_Ure2p 96..219 CDD:198326 33/132 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I1854
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm9258
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.