DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and gst1

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_588298.1 Gene:gst1 / 2538694 PomBaseID:SPCC191.09c Length:229 Species:Schizosaccharomyces pombe


Alignment Length:202 Identity:65/202 - (32%)
Similarity:88/202 - (43%) Gaps:43/202 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ELDL----RLVNVKAGEHKSAEFLKLNAQHTIPVLDD---NGTIVSDSHIICSYLADKYAPEGDD 86
            ||||    |.||....|.||.|.|.||....:|.|.|   |...:.:|..|..||||||..|...
pombe    24 ELDLTYETRYVNFSKNEQKSPEHLALNPNGRVPTLIDHHNNDYTIWESDAILIYLADKYDTERKI 88

  Fly    87 SLYPKD-PEKRRLVDARLYYDCGHLFPRIRFIVEPVIYFGAG--------EVPSDRVAY---LQK 139
            || |:| ||..:::....:...|          :.:|:..||        .|.|....|   :::
pombe    89 SL-PRDHPEYYKVIQYLFFQASG----------QGIIWGQAGWFSVYHQELVISAITRYRNEIKR 142

  Fly   140 AYDGLEHCLAEGDYLVGDKLTIADLSCIA-----SVSTAEAFAPIEPD--------QFPRLVQWV 191
            ....||..|.:.||||.::.||||||.|:     .:..||....||.:        :|||...|.
pombe   143 VLGVLEDILKDRDYLVANRFTIADLSFISWNNFLEIIFAEGKFSIEEEVPQLDFEKEFPRTYSWH 207

  Fly   192 KRIQALP 198
            :|:.|.|
pombe   208 QRLLARP 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 64/200 (32%)
GST_N_Delta_Epsilon 5..78 CDD:239343 22/55 (40%)
GST_C_Delta_Epsilon 94..211 CDD:198287 33/129 (26%)
gst1NP_588298.1 GST_N_Ure2p_like 3..84 CDD:239346 26/59 (44%)
GstA 5..218 CDD:223698 65/202 (32%)
GST_C_Ure2p 96..219 CDD:198326 33/129 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I1854
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm9258
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.