DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and AIMP3

DIOPT Version :10

Sequence 1:NP_611339.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_660194.1 Gene:AIMP3 / 246507 FlyBaseID:FBgn0050185 Length:179 Species:Drosophila melanogaster


Alignment Length:100 Identity:24/100 - (24%)
Similarity:45/100 - (45%) Gaps:14/100 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 RLVDARLYYDCGHLFPRIRFIVEPVIYFGAGEVPSDRVAYLQKAYDGLEHCLAEGDYLVGDKLTI 161
            |.|:|::|          ::|...|:|...|.  .|:....|...| .....|...||||..:|:
  Fly    65 REVEAQVY----------QWIEFSVLYVAPGS--KDKYVSKQLLAD-FNKLFASKSYLVGHFITL 116

  Fly   162 ADLSCIASV-STAEAFAPIEPDQFPRLVQWVKRIQ 195
            |||:...:: ...::.:|::.:.:..|.:|...:|
  Fly   117 ADLAVYYAIYDLVKSLSPVDKEVYLNLSRWFDHLQ 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_611339.1 GST_N_Delta_Epsilon 5..78 CDD:239343
GST_C_Delta_Epsilon 94..211 CDD:198287 23/99 (23%)
AIMP3NP_660194.1 GST_C_AIMP3 65..166 CDD:198338 23/99 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.