DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and Gstp3

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:XP_030106733.1 Gene:Gstp3 / 225884 MGIID:2385078 Length:260 Species:Mus musculus


Alignment Length:228 Identity:52/228 - (22%)
Similarity:89/228 - (39%) Gaps:44/228 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AKPILYYA-PRSPP--CR-AVLLTAAALGLELDL------------RLVNVKAGEHKSAEFLKLN 51
            |:.|:::. |.:|.  || .|..|....|.:.||            |::....|:....|.:.|:
Mouse    23 AQTIVFWVIPGNPQQWCRKGVTKTVLGPGRDRDLGQDYSCGRCEVMRMLLADQGQSWKEEVVTLD 87

  Fly    52 A--QHT---------IPVLDDNGTIVSDSHIICSYLADKYAPEGDDSLYPKDPEKRRLVDARLYY 105
            .  |.|         ||...|....:..|:.|..:|...:      .||.||.::..|||  :..
Mouse    88 VWEQGTFKASCLFGQIPKFQDGELTLYQSNTILRHLGRSF------GLYGKDQQEAALVD--MVN 144

  Fly   106 D-CGHLFPRIRFIVEPVIYFGAGEVPSDRVAYLQKAYDGLEHCLAEG----DYLVGDKLTIADLS 165
            | ...||.||......::..|..:...:...:|:.    .|..||:.    .::|||:::.||..
Mouse   145 DGLEDLFRRIARQYRHILKEGKDQYQKELPGHLKP----FETLLAQNRGGQSFIVGDQISFADYR 205

  Fly   166 CIASVSTAEAFAPIEPDQFPRLVQWVKRIQALP 198
            .:..:...|...|...:.||....:|.|:::.|
Mouse   206 LLDVLLNLELLFPGYLNDFPLFSAYVARLKSRP 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 50/224 (22%)
GST_N_Delta_Epsilon 5..78 CDD:239343 22/99 (22%)
GST_C_Delta_Epsilon 94..211 CDD:198287 25/110 (23%)
Gstp3XP_030106733.1 Thioredoxin_like 63..126 CDD:381987 12/62 (19%)
GST_C_family 134..253 CDD:383119 25/111 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.