DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and gst-43

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_491070.1 Gene:gst-43 / 190586 WormBaseID:WBGene00001791 Length:214 Species:Caenorhabditis elegans


Alignment Length:197 Identity:54/197 - (27%)
Similarity:93/197 - (47%) Gaps:20/197 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AKPILYYAPRSPPCRAVLLTAAALGLELDLRLVNVKAGEHK-SAEFLKLNAQHTIPVLDDNGTIV 66
            ||||||...||.....|.:..|...::.:.|.:::.:.|.| :|||:|.|....:|.|..||..:
 Worm     2 AKPILYSYWRSSCAWRVRIALALKNIDYEYRPIDLFSEESKNNAEFVKHNPAKKVPTLVINGLSL 66

  Fly    67 SDSHIICSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLFPRIRFIV-------EPVIYF 124
            ::|..|..||.:.|.   |....||:.:||....|...:....:.|.....:       ||    
 Worm    67 TESLAIIEYLDEAYP---DPPFLPKELDKRSYSRAIALHIVASIQPLQAINIHKMLNEKEP---- 124

  Fly   125 GAGEVPSDRVAYLQKAYDGLEHCLAE--GDYLVGDKLTIADLSCIASVSTAEAFAPIEPDQFPRL 187
            |.|:...:.  ::.|.:..||..|.:  |.|.|||:|||||::..:.:..|:.: .::..::|.:
 Worm   125 GYGDFWCNH--FVNKGFLALEELLKKHSGKYCVGDQLTIADINLPSIIYNAKIY-KVDMSKYPTI 186

  Fly   188 VQ 189
            .:
 Worm   187 TR 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 52/195 (27%)
GST_N_Delta_Epsilon 5..78 CDD:239343 24/73 (33%)
GST_C_Delta_Epsilon 94..211 CDD:198287 24/105 (23%)
gst-43NP_491070.1 GST_N_Zeta 4..77 CDD:239340 23/72 (32%)
maiA 5..211 CDD:273527 51/194 (26%)
GST_C_Zeta 90..207 CDD:198300 24/106 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163456
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.