DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and Y53G8B.1

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_497662.1 Gene:Y53G8B.1 / 190243 WormBaseID:WBGene00021817 Length:213 Species:Caenorhabditis elegans


Alignment Length:220 Identity:63/220 - (28%)
Similarity:106/220 - (48%) Gaps:28/220 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAKPILYYAPRSPPCRAVLLTAAAL-GLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGT 64
            |:||||| |:..|..|.:.:.||.|| .::.:.:.||: ..:.|..||...|....:|:|..||.
 Worm     1 MAAKPIL-YSSWSSGCSSRVRTALALKKIDYEYQPVNL-LNKQKEQEFHGNNPAEKVPILKINGL 63

  Fly    65 IVSDSHIICSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLFPRIRFIVEPVIYF----- 124
            .:::|..|..||.:.|.   |..|.||:||    :.||......|:...|:.:....||.     
 Worm    64 TLTESMAIIEYLDEIYP---DPPLLPKEPE----LKARARAIAFHIASNIQPLQNKPIYLMLNEK 121

  Fly   125 --GAGEVPSDRVAYLQKAYDGLEHCLA--EGDYLVGDKLTIADLSCIASV--STAEAFAPIEPDQ 183
              |.|:.....  ::.|.:..||..|.  .||:.||::::|||: |:.|:  :..|.: .::...
 Worm   122 EPGYGDFWCQH--FISKGFKALEELLQMHSGDFCVGNQISIADI-CLPSIVYNAIEKY-HVDMTP 182

  Fly   184 FPRLVQWVKRIQALPYYQ---KNNQ 205
            :|.:.:...::..||.:|   .|||
 Worm   183 YPIITRISNKLAELPEFQVAHPNNQ 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 54/204 (26%)
GST_N_Delta_Epsilon 5..78 CDD:239343 24/73 (33%)
GST_C_Delta_Epsilon 94..211 CDD:198287 30/126 (24%)
Y53G8B.1NP_497662.1 Thioredoxin_like 5..76 CDD:294274 23/72 (32%)
maiA 18..211 CDD:273527 54/202 (27%)
GST_C_Zeta 89..207 CDD:198300 29/125 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163443
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.