DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and gst-15

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_496860.1 Gene:gst-15 / 185410 WormBaseID:WBGene00001763 Length:213 Species:Caenorhabditis elegans


Alignment Length:166 Identity:44/166 - (26%)
Similarity:67/166 - (40%) Gaps:44/166 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 IPVLDDNGTIVSDSHIICSYLADKYAPEGDDSLYPKDPEKRRLVDARL--YYDCGHLFPRIRF-- 116
            :|||:.:|..:..|..||.|||.|:...|      |.||:....||.:  :.|....|..:.|  
 Worm    55 LPVLNVDGFDIPQSAAICRYLAKKFGYAG------KTPEEEAWADAVVDQFKDFSVAFKTLLFAT 113

  Fly   117 ---------------IVEPV--IYFGAGEVPSDRVAYLQKAYDGLEHCLAEGDYLVGDKLTIADL 164
                           |..|.  :||    :..:|:  |:|:..|         |||||.||.|||
 Worm   114 RAGKPEEEILKIRYEIFNPARDVYF----ILLNRI--LKKSKSG---------YLVGDGLTWADL 163

  Fly   165 SCIASVSTAEAFAPIEPDQ--FPRLVQWVKRIQALP 198
            ....::.:.|....|:.|.  ...|.::.::|...|
 Worm   164 VIADNLHSLEKLRAIDDDDEGHQNLKKYKEKIYGTP 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 43/164 (26%)
GST_N_Delta_Epsilon 5..78 CDD:239343 9/21 (43%)
GST_C_Delta_Epsilon 94..211 CDD:198287 30/128 (23%)
gst-15NP_496860.1 GST_N_Sigma_like 4..77 CDD:239337 9/21 (43%)
PTZ00057 6..211 CDD:173353 44/166 (27%)
GST_C_Sigma_like 87..195 CDD:198301 28/122 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.