DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and gst-19

DIOPT Version :10

Sequence 1:NP_611339.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_496864.1 Gene:gst-19 / 175010 WormBaseID:WBGene00001767 Length:207 Species:Caenorhabditis elegans


Alignment Length:219 Identity:51/219 - (23%)
Similarity:76/219 - (34%) Gaps:52/219 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 WIMTITFLKEFQFNN---------VFREQRIETGEHGFLIATLEAAIVYISCGSIARTQRLGVRL 395
            |....|.:.|..|.|         :..|::.:..|    ||.||...|.:|..:...:...|..|
 Worm    33 WFDFRTDVLEENFQNEKYCELVWRILTEKKRQVTE----IAELERVSVSVSAQNDTASSGSGGDL 93

  Fly   396 ------DRARGLAGTPPDSDSDSTGSASTGDWEFRCADDFLDYLLALMR---NDD------EVRI 445
                  |..:.|:.|.||||:.|...|...|.......|........:|   |||      |.|:
 Worm    94 HEIDSSDSDKTLSTTLPDSDTSSAKLALDDDENTSSISDAQTAQTVQIRDSSNDDTEDIEPETRL 158

  Fly   446 ------------VELLQDI-TNNQALLCGGPTEAGYYYLPS-IDDQ---------NRQGQAAIHL 487
                        ||:.:|. |::..:|.....||..:...| :.||         ..:..:||..
 Worm   159 MPHETAANDPLTVEVAEDADTSSSPVLESKIDEAEEHSCSSLVTDQVFDPIKQALENKSSSAISR 223

  Fly   488 AAILGNAKLLTLILSLQPNVNAVD 511
            .:| |.:.|..|.|..:...|..|
 Worm   224 ESI-GGSTLRPLHLETREKANTTD 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_611339.1 GST_N_Delta_Epsilon 5..78 CDD:239343
GST_C_Delta_Epsilon 94..211 CDD:198287
gst-19NP_496864.1 GST_N_Sigma_like 4..72 CDD:239337 9/42 (21%)
GST_C_Sigma_like 83..189 CDD:198301 24/105 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.