DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and Gstt1

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_032211.3 Gene:Gstt1 / 14871 MGIID:107379 Length:240 Species:Mus musculus


Alignment Length:213 Identity:61/213 - (28%)
Similarity:95/213 - (44%) Gaps:40/213 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LYYAPRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSDSHI 71
            ||....|.||||:.:.|....:...:..|.::.|||.|..|.::|....:|.:.|.|..:.:|..
Mouse     5 LYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFARVNPMKRVPAMMDGGFTLCESVA 69

  Fly    72 ICSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGH----------LFPRIRFIVEPVIYFGA 126
            |..|||.||  :..|..||:|.:.|..||..|.:.  |          |:.::.|   ||  |..
Mouse    70 ILLYLAHKY--KVPDHWYPQDLQARARVDEYLAWQ--HTGLRRSCLRALWHKVMF---PV--FLG 125

  Fly   127 GEVPSDRVA--------YLQKAYDGLEHCLAEGDYLVGDKLTIADLSCIASVSTAEAFAPIEP-- 181
            .::|.:.:|        .||...|..   |.:.|:|||..:::|||     |:..|...|:..  
Mouse   126 EQIPPETLAATLAELDVNLQVLEDKF---LQDKDFLVGPHISLADL-----VAITELMHPVGGGC 182

  Fly   182 ---DQFPRLVQWVKRIQA 196
               :..|||..|.:|::|
Mouse   183 PVFEGHPRLAAWYQRVEA 200

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 61/213 (29%)
GST_N_Delta_Epsilon 5..78 CDD:239343 22/70 (31%)
GST_C_Delta_Epsilon 94..211 CDD:198287 32/126 (25%)
Gstt1NP_032211.3 GstA 3..212 CDD:223698 61/213 (29%)
GST_N_Theta 3..78 CDD:239348 23/72 (32%)