DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and CLIC2

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001280.3 Gene:CLIC2 / 1193 HGNCID:2063 Length:247 Species:Homo sapiens


Alignment Length:183 Identity:39/183 - (21%)
Similarity:66/183 - (36%) Gaps:35/183 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSDSHIICSYLAD 78
            |.|:.:.:.....|::.::..|::   ..|..|...|......|.|..|..:.:|...|..:|..
Human    31 PFCQRLFMILWLKGVKFNVTTVDM---TRKPEELKDLAPGTNPPFLVYNKELKTDFIKIEEFLEQ 92

  Fly    79 KYAPEGDDSLYPKDPEKRRLVDARLYYDCG-HLFPRIRFIVEPVIYFGAGEVPSDRVAYLQKAYD 142
            ..||.....|.||..|.         :|.| :||.:....::..    ..|...:....|.|.:.
Human    93 TLAPPRYPHLSPKYKES---------FDVGCNLFAKFSAYIKNT----QKEANKNFEKSLLKEFK 144

  Fly   143 GLEHCL------------AEGD------YLVGDKLTIADLSCIASVSTAEAFA 177
            .|:..|            ||..      :|.||:||:||.|.:..::..:..|
Human   145 RLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAA 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 39/183 (21%)
GST_N_Delta_Epsilon 5..78 CDD:239343 13/63 (21%)
GST_C_Delta_Epsilon 94..211 CDD:198287 21/103 (20%)
CLIC2NP_001280.3 Required for insertion into the membrane. /evidence=ECO:0000250 1..96 13/67 (19%)
N-terminal 1..94 13/65 (20%)
O-ClC 12..245 CDD:129941 39/183 (21%)
Joint loop 95..106 4/10 (40%)
C-terminal 107..247 21/104 (20%)
Foot loop 151..171 2/19 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154413
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.