DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE11 and eef1e1

DIOPT Version :9

Sequence 1:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001107137.1 Gene:eef1e1 / 100038230 XenbaseID:XB-GENE-493638 Length:174 Species:Xenopus tropicalis


Alignment Length:177 Identity:36/177 - (20%)
Similarity:66/177 - (37%) Gaps:45/177 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 RLVNVKAGEHKSAEFLKLNAQHTIPVLDDN-GTIVSDSHIICSYLADKYAPEGDDSLYPKDPEKR 96
            :.:.:.:|::.|    :......||||..| |..:.....|.|:|..:...|   .|.....|::
 Frog    11 KCLGLNSGKYSS----RAQGAGKIPVLQTNKGPSLVGLSTIASHLVKEAKKE---ELLGSTAEEK 68

  Fly    97 RLVDARLYYDCGHLFPRIRFIVEPVIYFGAGEVPSDRVAY---LQKAYDGLEHCLAEGDYLVGDK 158
            .:|...|.|       ||.:|              ||.:.   ::...:.|.|.|.:..::.|:.
 Frog    69 AIVQQWLEY-------RISYI--------------DRASSKEDIRNVLNDLNHYLKDKVFVAGNT 112

  Fly   159 LTIADL-------SCIASVSTAEAFAPIEPDQFPRLVQWVKRIQALP 198
            :|:||:       ..|..:|..      |.:.:..:.:|...||..|
 Frog   113 VTLADILIYYGLHPVITGLSVQ------EKETYINVSRWFSHIQNYP 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE11NP_001286575.1 GstA 5..198 CDD:223698 35/175 (20%)
GST_N_Delta_Epsilon 5..78 CDD:239343 11/45 (24%)
GST_C_Delta_Epsilon 94..211 CDD:198287 23/115 (20%)
eef1e1NP_001107137.1 GST_C_AIMP3 65..165 CDD:198338 23/116 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.