DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30116 and wda

DIOPT Version :9

Sequence 1:NP_725799.1 Gene:CG30116 / 37126 FlyBaseID:FBgn0028496 Length:1922 Species:Drosophila melanogaster
Sequence 2:NP_651136.1 Gene:wda / 42750 FlyBaseID:FBgn0039067 Length:743 Species:Drosophila melanogaster


Alignment Length:314 Identity:68/314 - (21%)
Similarity:126/314 - (40%) Gaps:58/314 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1189 YSRHPRRKRSLKRHAQAQRSPST----TLPPITCFDLSRDSQQMAIASGRHVHLMRINTPEY-QC 1248
            |.|:|:::...:.:..|.:...|    :...:.|.:..|..:..|    ||......:..|| ..
  Fly   431 YRRYPQKRCPWELNNCANQEEETDEDSSDEDVKCSEEERRERNRA----RHCKYADNSYNEYGGF 491

  Fly  1249 TLEGHTAGVSCLKFAPNGEFLATGSEDRLVHIW---NLALGEICNSFKGHTAPVVKVVVLMDSLR 1310
            .|.|||.||:.::|:.:...:.:.|:|..:..|   ||....|   ::.|..|            
  Fly   492 QLRGHTKGVTDVRFSAHYPLMYSVSKDATMRCWRAHNLHCAAI---YRSHNYP------------ 541

  Fly  1311 VISTDRDSMLLVWMAHSGNLLQTIQGPYKSLSVTNNMRFAVSTNGDNTLKIWSLTQEDEK--YSV 1373
                       :|......:.|                :.|:.:.|.:.::|||.:|...  |: 
  Fly   542 -----------IWCLDESPVGQ----------------YVVTGSKDLSARLWSLEKEHALIIYA- 578

  Fly  1374 SHSDEITCFEISADSVHIISGSRDMSLKVWQATGGKLSQVLVGHSDAVTCVAVSVTNKTQVLSGS 1438
            .|:.::.|.....:..:|.:||.|.|:::|.||.|||.:|......|||.:|.|...|....:| 
  Fly   579 GHTQDVECVAFHPNGNYIATGSADHSVRLWCATSGKLMRVFADCRQAVTQLAFSPDGKMLAAAG- 642

  Fly  1439 KDMNLILWDLLTGEEVHTLAGHLGPVIGVKVSADGSTAVSGSDDKTLIVWETKR 1492
            ::..:.::||..|.::..|..|...:..:..|.......:...|.||.:|:.|:
  Fly   643 EETKVRIFDLAAGAQLAELKDHSASISSLSWSTHNRHLATACSDGTLRLWDIKK 696

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30116NP_725799.1 AAA_16 359..505 CDD:289934
WD40 repeat 901..937 CDD:293791
WD40 933..1282 CDD:238121 22/100 (22%)
WD40 repeat 942..982 CDD:293791
WD40 repeat 988..1024 CDD:293791
WD40 1022..1484 CDD:225201 64/304 (21%)
WD40 repeat 1029..1064 CDD:293791
WD40 repeat 1071..1106 CDD:293791
WD40 repeat 1112..1147 CDD:293791
WD40 repeat 1216..1252 CDD:293791 8/36 (22%)
WD40 1248..1502 CDD:238121 56/250 (22%)
WD40 repeat 1258..1294 CDD:293791 7/38 (18%)
WD40 repeat 1299..1335 CDD:293791 2/35 (6%)
WD40 repeat 1340..1374 CDD:293791 7/35 (20%)
WD40 repeat 1379..1415 CDD:293791 13/35 (37%)
WD40 repeat 1421..1458 CDD:293791 9/36 (25%)
WD40 repeat 1464..1488 CDD:293791 4/23 (17%)
wdaNP_651136.1 TAF5_NTD2 104..273 CDD:298747
WD40 324..>700 CDD:225201 68/314 (22%)
WD40 491..700 CDD:238121 56/250 (22%)
WD40 repeat 501..537 CDD:293791 7/38 (18%)
WD40 repeat 542..578 CDD:293791 8/51 (16%)
WD40 repeat 585..619 CDD:293791 12/33 (36%)
WD40 repeat 626..662 CDD:293791 9/36 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4155
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.