DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30116 and LOC362863

DIOPT Version :9

Sequence 1:NP_725799.1 Gene:CG30116 / 37126 FlyBaseID:FBgn0028496 Length:1922 Species:Drosophila melanogaster
Sequence 2:NP_001164076.1 Gene:LOC362863 / 362863 RGDID:1302940 Length:1312 Species:Rattus norvegicus


Alignment Length:600 Identity:123/600 - (20%)
Similarity:214/600 - (35%) Gaps:149/600 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IDESVLNALRGVTSAHTRLPKPLLIKIYVASLKQEFNQERRMLLELVGPELQSLYDDRQIELEFV 69
            |:|::..|.|..:....:..||  |:.|:.| ..:|..||..|.:.:.|:|......|....:.|
  Rat     2 IEEAIETAQRYNSQPILKRQKP--IRPYICS-TIDFQDERDFLAKTIFPQLNDFCSSRGTYFKAV 63

  Fly    70 DMHFGTGDLEVHQ-LERDPYLIHDYLHE---------IDTCHAHTKSVFFMVLVGDGIGRQLLPT 124
            |:.:..  |:.|: ...:.:..:..||.         ::.|..     ||:.|:|...| ..|| 
  Rat    64 DLRWSA--LKAHKSFTNNQFRQYSCLHSQHLKLCLDYVNRCFP-----FFICLLGQTYG-DFLP- 119

  Fly   125 KIDEDIFSAVLADQQTSADHEAMLV------KWYER--DASQTQRQLKQDYRLMNVDAWLAESQR 181
            .....:.|.|...:..|...:.:.|      .|..:  :.|.|:.::        :.|...:..:
  Rat   120 DYTPFLLSKVKDLESLSKGEQNLYVAAKNGYPWVLKTPNCSLTEFEI--------IQAAFRKKSQ 176

  Fly   182 MQSFLEQAFQSLLQGSGASGRSPDFMERVQLLRRTQIEREVSQAMALTSEKILAVFRERAAQCSK 246
            .|.|..:...|||:         .|.|..:     :.|.::|....:..:..:.|.:.:|....|
  Rat   177 FQFFYFRTSNSLLR---------TFSEEEE-----EEEEKLSSGYQVDRQGKVKVGKLKAKIIGK 227

  Fly   247 GDVEAAERLRKIKDELTMNLSTDNHTTLVVPGSAASEAIDP-----DNEDHESYLSKFKNKVTDK 306
            |   ...|..:..|||...:..|        .||..|.:.|     :|.|   |...|:|     
  Rat   228 G---LPVRFYRDLDELGDMVLKD--------WSAVVEELYPVTMIMENID---YKHSFEN----- 273

  Fly   307 LRLLIEAHITNDPDVI---KGRKKTVQEIFHEHATHLRILREHTDSDALVESRVPQQLRQNLMAN 368
              |..|..:.|...|.   |...:|.:.:.......|.:..:.|.:.|.::|    .||.|.:..
  Rat   274 --LYHEEFVENCKQVFVISKESNRTFEMLERFAIKDLELNSDSTVAGAGLDS----ILRINSLPT 332

  Fly   369 FRNGSRHAPYFLCGADGSGKSAILCHLYGQVGSWFGSTR-----VHRVIRFAKATPRSAYNLELL 428
            .:     :...|||..|.|||.:       :.:|....:     |..|..|..:|..|...:.::
  Rat   333 CK-----SILLLCGERGCGKSTL-------IANWVDDFKSRHPGVLMVPYFVGSTCESCDIMSVM 385

  Fly   429 RVICQQISIIFNIPEGYLPKDASFDPLYINTWFQNLLRRVEDMGNDVLFLFIDDLHL----LNPL 489
            .....::....|.|:  |..|      ::|          || .|.::|..:.::.:    |.| 
  Rat   386 HYFIMELQHRANGPQ--LEMD------FLN----------ED-SNVLVFSLLIEVFMAAISLKP- 430

  Fly   490 DCDIV------------------TALSWLPTSLPWNVQIICSSTTPVEQLKFTPMQRDRFKSIEY 536
             |.:|                  ...||||.|||.:.:.|.||.:.....| :...|...|::|.
  Rat   431 -CILVLDGIEELVGIYGISGQKAKDFSWLPRSLPPHCKFILSSVSSSLSCK-SLCARPDVKTVEL 493

  Fly   537 QFDLNMGDYATKLKI 551
            .   ::||..||..|
  Rat   494 N---SLGDEDTKFSI 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30116NP_725799.1 AAA_16 359..505 CDD:289934 34/172 (20%)
WD40 repeat 901..937 CDD:293791
WD40 933..1282 CDD:238121
WD40 repeat 942..982 CDD:293791
WD40 repeat 988..1024 CDD:293791
WD40 1022..1484 CDD:225201
WD40 repeat 1029..1064 CDD:293791
WD40 repeat 1071..1106 CDD:293791
WD40 repeat 1112..1147 CDD:293791
WD40 repeat 1216..1252 CDD:293791
WD40 1248..1502 CDD:238121
WD40 repeat 1258..1294 CDD:293791
WD40 repeat 1299..1335 CDD:293791
WD40 repeat 1340..1374 CDD:293791
WD40 repeat 1379..1415 CDD:293791
WD40 repeat 1421..1458 CDD:293791
WD40 repeat 1464..1488 CDD:293791
LOC362863NP_001164076.1 AAA_22 334..>441 CDD:379165 26/139 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19871
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.