DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30116 and Dcaf10

DIOPT Version :9

Sequence 1:NP_725799.1 Gene:CG30116 / 37126 FlyBaseID:FBgn0028496 Length:1922 Species:Drosophila melanogaster
Sequence 2:NP_694807.2 Gene:Dcaf10 / 242418 MGIID:2140179 Length:566 Species:Mus musculus


Alignment Length:385 Identity:77/385 - (20%)
Similarity:117/385 - (30%) Gaps:190/385 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly   392 LCHLYGQV---GSWFGSTRVHRVIRFAKATPRSAYNLE------LLRVICQQISIIFNIPEGYLP 447
            :.:|||.:   .|.:.|||.|..:          :|||      :|.|.|:|..::.        
Mouse   155 MTNLYGSIHPADSVYLSTRTHGAV----------FNLEYSPDGSVLTVACEQTEVLL-------- 201

  Fly   448 KDASFDPL---YINTWFQNLLRRVEDMGNDVLFL--------------FIDDLHLLNPLDCDIVT 495
                |||:   :|.|    |....||..|::.||              .:.||..||...|.:..
Mouse   202 ----FDPISSKHIKT----LSEAHEDCVNNIRFLDNRLFATCSDDTTIALWDLRKLNTKVCTLHG 258

  Fly   496 ALSWLPTSLPWNVQIICSSTTPVEQLKFTPMQRDRFKSIEYQFDLNMGDYATKLKIPPQCIPGDV 560
            ..||:                               |:|||                      |.
Mouse   259 HTSWV-------------------------------KNIEY----------------------DT 270

  Fly   561 SFALYVEQQFDQLERHYGRQAVGDLASYIT--CSEYGLSETE------LLELLMPTDDPESLIET 617
            :..|.|...||           |::..:.|  |:|.|....:      |:.:.:..|..:.||.|
Mouse   271 NTRLLVTSGFD-----------GNVIIWDTNRCTEDGCPHKKFFHTRFLMRMRLTPDCSKMLIST 324

  Fly   618 KNGHFSFATFKKIHREMDLLLLLHDKIMSGKVLIQWRHNYCASVAKRRYMDVQRTRSLHCELANL 682
            .:|:               ||:||:                        :|:  |:||  |:.: 
Mouse   325 SSGY---------------LLILHE------------------------LDL--TKSL--EVGS- 345

  Fly   683 FFPQDEDESTLENESNRSESKSVISLKDRDREKDSLSAVSAVSAGRKSSS-THHNDDTST 741
             :|                    |....|......|:..|:.|..|.|.| .||||..||
Mouse   346 -YP--------------------ILRARRTTSSSDLTTTSSSSGSRVSGSPCHHNDSNST 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30116NP_725799.1 AAA_16 359..505 CDD:289934 33/138 (24%)
WD40 repeat 901..937 CDD:293791
WD40 933..1282 CDD:238121
WD40 repeat 942..982 CDD:293791
WD40 repeat 988..1024 CDD:293791
WD40 1022..1484 CDD:225201
WD40 repeat 1029..1064 CDD:293791
WD40 repeat 1071..1106 CDD:293791
WD40 repeat 1112..1147 CDD:293791
WD40 repeat 1216..1252 CDD:293791
WD40 1248..1502 CDD:238121
WD40 repeat 1258..1294 CDD:293791
WD40 repeat 1299..1335 CDD:293791
WD40 repeat 1340..1374 CDD:293791
WD40 repeat 1379..1415 CDD:293791
WD40 repeat 1421..1458 CDD:293791
WD40 repeat 1464..1488 CDD:293791
Dcaf10NP_694807.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..72
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..123
WD40 <171..326 CDD:295369 48/244 (20%)
WD 1 173..212 13/60 (22%)
WD40 <178..>326 CDD:225201 44/237 (19%)
WD40 repeat 179..214 CDD:293791 12/50 (24%)
WD 2 216..254 9/37 (24%)
WD40 repeat 221..257 CDD:293791 8/35 (23%)
WD 3 258..297 15/102 (15%)
WD40 repeat 263..289 CDD:293791 10/89 (11%)
WD 4 303..342 14/81 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 354..413 12/31 (39%)
WD 5 415..455
WD 6 477..515
WD40 524..562 CDD:197651
WD 7 533..566
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4155
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.