DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rswl and TRMT10A

DIOPT Version :9

Sequence 1:NP_611335.1 Gene:rswl / 37124 FlyBaseID:FBgn0034351 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001128137.1 Gene:TRMT10A / 93587 HGNCID:28403 Length:339 Species:Homo sapiens


Alignment Length:335 Identity:80/335 - (23%)
Similarity:139/335 - (41%) Gaps:104/335 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 ISENKEERDK-RLKVLQLEADIAHQEG------RRVPSLEFFKDHHWEHVLTLPTKSARIKYFGY 118
            |:|::||..| ||           .||      |::..|  .|...||.                
Human    21 INEDQEESQKPRL-----------GEGCEPISKRQMKKL--IKQKQWEE---------------- 56

  Fly   119 LWQIEMKKEADQRKKAERAKEAERRVAEMRKEREENTHIIYGLGHTSLFLR--IYDTTINHWQNN 181
              |.|::|:  :||:..:.|:.||:.     :.|.|:.     ||....:|  :..:|:      
Human    57 --QRELRKQ--KRKEKRKRKKLERQC-----QMEPNSD-----GHDRKRVRRDVVHSTL------ 101

  Fly   182 RLTRAMQFAPKMVLDCSYDEHMNNREATYAAKQLMMCFAENRMNDEPFDLHYCNTQMDSRCMQSL 246
                      ::::|||:|..|..::.....||:..|:||||                 |.:..:
Human   102 ----------RLIIDCSFDHLMVLKDIKKLHKQIQRCYAENR-----------------RALHPV 139

  Fly   247 QRYIPTMHNPEFPIN-------------LHSK--CFTELFPKQNLVYLTPHCREDLVTYNPDDIY 296
            |.|: |.|..:...|             :|.|  .::||..|::|:|||......|...:....|
Human   140 QFYL-TSHGGQLKKNMDENDKGWVNWKDIHIKPEHYSELIKKEDLIYLTSDSPNILKELDESKAY 203

  Fly   297 IVGAMVDTMNNEPLSLAKAKRLGLRMARLPLDRYLQWGSGSGKSLTLNQMINIMLDLKKTGDWDT 361
            ::|.:||..:::.|:..:|...|:..|:|||..:::  ..|.|.|.:|.:..|:|:..:|.||..
Human   204 VIGGLVDHNHHKGLTYKQASDYGINHAQLPLGNFVK--MNSRKVLAVNHVFEIILEYLETRDWQE 266

  Fly   362 ALKHV-PRRK 370
            |...: |:||
Human   267 AFFTILPQRK 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rswlNP_611335.1 tRNA_m1G_MT 201..370 CDD:294285 46/184 (25%)
TRMT10ANP_001128137.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..90 26/111 (23%)
Trm10euk_A 101..276 CDD:349974 50/210 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 282..339
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2967
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1545
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.