DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rswl and TRM10

DIOPT Version :9

Sequence 1:NP_611335.1 Gene:rswl / 37124 FlyBaseID:FBgn0034351 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_199579.1 Gene:TRM10 / 834819 AraportID:AT5G47680 Length:344 Species:Arabidopsis thaliana


Alignment Length:365 Identity:90/365 - (24%)
Similarity:157/365 - (43%) Gaps:87/365 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 FVNPFSQPAPALSNDTISENKEERDKRLKVLQLEADIAHQEGRRVPSLEFFKDH----------H 99
            |..|.|:|||...:..:|:|.::  |:||..:.||..|.::.:.       |:|          .
plant    13 FDKPESEPAPVNVSPPLSKNAQK--KQLKQQRYEAKKAEKKAQE-------KEHKRKEGERKLKE 68

  Fly   100 WEHVLTLPTKSARIKYFGYLWQIEMKKEADQRKKAERAKEAERRVAEMRKEREENTHIIYGLGHT 164
            ||..|...|:..|:|.      ||.:|...:.:..:|::|.|:::                    
plant    69 WEETLANATEEERLKL------IESRKSLRKERMEKRSEEKEKKI-------------------- 107

  Fly   165 SLFLRIYDTTINHWQNNRLTRAMQFAPKMVLDCSYDEHMNNREATYAAKQLMMCFAENRMNDEPF 229
                            .||.:|.:...|:|:|..:...|:..|.:...:|:|.|:|.|..:..| 
plant   108 ----------------ERLNQAKEIGQKIVVDVDFAHLMSESEISSLVQQIMYCYAVNGRSTSP- 155

  Fly   230 DLHYCNTQMDSRCMQSLQRYIPTMHNPEFP---INLHSKCFTELF--PKQNLVYLTPHCREDLVT 289
             .|...|.:..:....|.:.      |.|.   |...|:|:.|..  .|.||||||......|..
plant   156 -CHLWLTGVQGKMSTELDKL------PGFEKWFIEKESRCYIEAMADQKDNLVYLTADSETVLDD 213

  Fly   290 YNPDDIYIVGAMVDTMNNEPLSLAKAKRLGLRMARLPLDRYLQWGSGSGKSLTLNQMINIMLDLK 354
            .:|..|||:|.:||....:.:::.||:..|::.|:||:..|::  ..|.:.||:||::.|::...
plant   214 LDPKHIYIIGGLVDRNRFKGITMTKAQEQGIKTAKLPIGEYMK--MSSSQVLTVNQVLEILVKFL 276

  Fly   355 KTGDWDTA-LKHVPRRK----------VVQNEFQPRREKD 383
            :|.||.|| ...:|:||          .:::..:..:|||
plant   277 ETRDWKTAFFTVIPQRKRTGLDPVDCSKLEHISEEHQEKD 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rswlNP_611335.1 tRNA_m1G_MT 201..370 CDD:294285 51/174 (29%)
TRM10NP_199579.1 tRNA_m1G_MT 129..293 CDD:294285 51/173 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2967
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13563
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.