DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rswl and SUN1

DIOPT Version :9

Sequence 1:NP_611335.1 Gene:rswl / 37124 FlyBaseID:FBgn0034351 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_196118.1 Gene:SUN1 / 830381 AraportID:AT5G04990 Length:471 Species:Arabidopsis thaliana


Alignment Length:269 Identity:48/269 - (17%)
Similarity:77/269 - (28%) Gaps:114/269 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ARWRLGSQLLKGCAAPVRQASKTSSAENLIAGTEEPQKKFVNPFSQPAPALSN------------ 58
            |||:          ..||..:|...|..:|.|..:..:|.:...|.|:..:|:            
plant   102 ARWK----------TVVRIFAKQLGALLIIVGLIQLTRKMILKASSPSSPISSYETEMAFSGLES 156

  Fly    59 -------------DTISENKEERDKRLKVLQLEADIAHQEGRRVPSLEFFKDHHWEHVLTLPTKS 110
                         :::....|..||:   ::.||.:..||..|..|                   
plant   157 RIAEVDGLVKATTNSMQVQVELLDKK---MEREAKVLRQEIERKAS------------------- 199

  Fly   111 ARIKYFGYLWQIEMKKEADQRKKAERA------------KEAERRVAEMRK-------------- 149
                    .:|.|:||...:.:..|::            .|.||...|::|              
plant   200 --------AFQSELKKIESRTESLEKSVDEVNAKPWVTKDELERIYEELKKGNVDDSAFSEISID 256

  Fly   150 ----------EREENTHIIYGLGHTSLFLRIYDTTI------------NHWQNNRLTRAMQFAPK 192
                      |:|...|...|||.....|......:            :.|....:.||...|.|
plant   257 ELRAYARDIMEKEIEKHAADGLGRVDYALASGGAFVMEHSDPYLVGKGSSWFATTMRRAHTNAVK 321

  Fly   193 MVLDCSYDE 201
            | |..|:.|
plant   322 M-LSPSFGE 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rswlNP_611335.1 tRNA_m1G_MT 201..370 CDD:294285 1/1 (100%)
SUN1NP_196118.1 Smc <153..>275 CDD:224117 22/151 (15%)
Sad1_UNC 313..450 CDD:369494 8/18 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.