DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rswl and trmt10b

DIOPT Version :9

Sequence 1:NP_611335.1 Gene:rswl / 37124 FlyBaseID:FBgn0034351 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001070749.1 Gene:trmt10b / 768135 ZFINID:ZDB-GENE-061013-313 Length:310 Species:Danio rerio


Alignment Length:283 Identity:81/283 - (28%)
Similarity:135/283 - (47%) Gaps:34/283 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 LEFFK-DHHWEHVLTLPTKSARIKYFGYLWQIEMKKEADQRKKAERAKEAERRVAEMRKE--REE 153
            |||.. |...||......:|||.|..       |:|:.:..::.| .|:::|:..::||:  |::
Zfish    28 LEFLHIDVELEHARDDREESARSKNV-------MRKQRNWERRLE-VKKSKRKEEKLRKKLNRQD 84

  Fly   154 NTHIIYGLGHTSLFLRIYDTTINHWQNNRLTRAMQFAPKMVLDCSYDEHMNNREATYAAKQLMMC 218
            .     .:....|..|:    |......||..|.....::.:|.|..||:.::|.:..|.|:...
Zfish    85 K-----DVSDAQLSKRV----IKAITKERLEGARAAGLRLCVDLSMTEHLTHKEISRLAAQIRRL 140

  Fly   219 FAENRMNDEPFDLHYCNTQMDS----RCMQSLQRYIPTMHNPEFPINLHSKCFTELFPKQNLVYL 279
            :..|:...:||.:.....|.||    .|:.....:   ||   :.|::..:.:..|||.::::||
Zfish   141 YGSNKKALQPFHVFLTELQEDSLLYKECVGMNDGF---MH---YLIDVTEESWFHLFPSEDVIYL 199

  Fly   280 TPHCREDLVTYNPDDIYIVGAMVDTMNNEPLSLAKAKRLGLRMARLPLDRYLQWGSG----SGKS 340
            ||...|.|.:...|.|||:|.:||...::.:|..|||.||:|.||||:|.|:.....    ..|.
Zfish   200 TPDASEALESVEEDKIYILGGLVDETIHKKISYTKAKELGVRTARLPIDEYMVKKENPKNFHSKI 264

  Fly   341 LTLNQMINIMLDLKKTGDWDTAL 363
            |.:||:.:|:|..:.|.||..||
Zfish   265 LAINQVFDILLTFRDTRDWTKAL 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rswlNP_611335.1 tRNA_m1G_MT 201..370 CDD:294285 55/171 (32%)
trmt10bNP_001070749.1 tRNA_m1G_MT 128..295 CDD:294285 53/166 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2967
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.