DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rswl and Trmt10b

DIOPT Version :9

Sequence 1:NP_611335.1 Gene:rswl / 37124 FlyBaseID:FBgn0034351 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_081542.2 Gene:Trmt10b / 69934 MGIID:1917184 Length:318 Species:Mus musculus


Alignment Length:354 Identity:81/354 - (22%)
Similarity:140/354 - (39%) Gaps:87/354 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 EEPQKKFVNPFSQP---APALSNDTISENKEERDKRLKVLQLEADIAHQEGRRVPSLEFF----- 95
            |..|:.....|.:|   ..|...|.:||:       .::||::.:....|.....:...:     
Mouse     7 ESAQRTDSQAFQEPDGLPEAGGEDGLSES-------FQLLQVDVEYERPEETSPANSAVWSSKNM 64

  Fly    96 --KDHHWEHVLTLPTKSARIKYFGYLWQIEMKKEADQRKKAERAKEAERRVAEMRKEREENTHII 158
              |..|||.:::                         .||::|.:|.|||.|    :|.|:.   
Mouse    65 QRKQRHWERIVS-------------------------SKKSKRKQERERRKA----KRAEDP--- 97

  Fly   159 YGLG----HTSLFLRIYDTTINHWQNNRLTRAMQFAPKMVLDCSYDEHMNNREATYAAKQLMMCF 219
             |.|    |:..||:..       ...:|..|....|::.:|.|..:||:.:|.:..|.|:...:
Mouse    98 -GNGTCPQHSKRFLKAL-------TKEKLLEAKHSGPRLCVDLSMTQHMSKKELSRLAGQIRRLY 154

  Fly   220 AENRMNDEPFDLHYCNTQMDS------RCMQSLQRYIPTMHNPEFPINL----HSKCFTELFPKQ 274
            ..|:....||.:  |.|...:      .|::.         |..|...|    ...||: |||.:
Mouse   155 GSNKKASRPFWI--CLTGFSTASPLYEECLRM---------NDGFSAYLLDVTEEDCFS-LFPLE 207

  Fly   275 NLVYLTPHCREDLVTYNPDDIYIVGAMVDTMNNEPLSLAKAKRLGLRMARLPLDRYL----QWGS 335
            .||||||.....|...:...:|::|.:||....:.::..||:...::.||||:..|:    ...:
Mouse   208 TLVYLTPDSEHSLEDIDQSTVYVIGGLVDESIQKKVTFQKAREYSVKTARLPIQEYMIKRQNEKN 272

  Fly   336 GSGKSLTLNQMINIMLDLKKTGDWDTALK 364
            ...:.|.:||:.:|:....:|.:|..|||
Mouse   273 YHSEILAINQVFDILSTYFETRNWPEALK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rswlNP_611335.1 tRNA_m1G_MT 201..370 CDD:294285 46/178 (26%)
Trmt10bNP_081542.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..105 27/137 (20%)
Trm10euk_B 126..308 CDD:349973 49/188 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2967
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.